Filters

AGO2 Antibody / Argonaute 2

AGO2 Antibody / Argonaute 2 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenAGO2 / Argonaute 2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions5-1ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis AGO2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9UKV8
PurityAntigen affinity
Description It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing, Multiple transcript variants encoding different isoforms have been found for this gene, The encoded protein is highly basic, This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference, also known as AGO2, and contains a PAZ domain and a PIWI domain, is a protein that in humans is encoded by the EIF2C2 gene, Protein argonaute-2
ImmunogenAmino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody
Storage After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the AGO2 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetAGO2 / Argonaute 2
Short nameAGO2 Antibody / Argonaute 2
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameAGO2 (Antibody to) / Argonaute 2
Alternative techniqueantibodies
Identity 3263
Gene AGO2
Long gene name RISC catalytic component , argonaute 2
Synonyms gene EIF2C2 CASC7
Synonyms gene name 2 argonaute RISC catalytic component 2 cancer susceptibility candidate 7 (non-protein coding) , eukaryotic translation initiation factor 2C
Synonyms hAGO2 Q10 LINC00980
Synonyms name argonaute 2
Locus 8q24, 3
Discovery year 2000-01-14
GenBank acession AF121255
Entrez gene record 27161
Pubmed identfication 10534406 12906857
RefSeq identity NM_012154
Classification Argonaute/PIWI family
Havana BLAST/BLAT OTTHUMG00000164232

Similar products

Subscribe to our Newsletter