Filters

AMPK beta 2 Antibody / PRKAB2

AMPK beta 2 Antibody / PRKAB2 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenAMPK beta 2 / PRKAB2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the PRKAB2 antibody should be determined by the researcher
Intented useThis PRKAB2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O43741
PurityAntigen affinity
Description AMPK is a heterotrimer consisting of an alpha catalytic subunit, AMPK is activated, In response to cellular metabolic stresses, It is an important energy-sensing enzyme that monitors cellular energy status, It is highly expressed in skeletal muscle and thus may have tissue-specific roles, Multiple alternatively spliced transcript variants have been found for this gene, The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK), This subunit may be a positive regulator of AMPK activity, and non-catalytic beta and gamma subunits, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol, 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene
ImmunogenAmino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE of human AMPK beta 2 were used as the immunogen for the PRKAB2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PRKAB2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetAMPK beta 2 / PRKAB2
Short nameAMPK beta 2 Antibody / PRKAB2
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name AMP-activated, b 2 non-catalytic subunit, AMPK b 2 (Antibody to) / protein phosphorylation catalyst
Alternative techniqueantibodies
Alternative to gene target AMP-activated, PRKAB2 and IDBG-101806 and ENSG00000131791 and 5565, PRKAB2 and IDBG-633860 and ENSBTAG00000014387 and 512665, Prkab2 and IDBG-177135 and ENSMUSG00000038205 and 108097, beta 2 non-catalytic subunit, identical protein binding, nuclei, this GO :0004679 and AMP-activated protein kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005654 and nucleoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006112 and energy reserve metabolic process and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006633 and fatty acid biosynthetic process and biological process this GO :0006853 and carnitine shuttle and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007165 and signal transduction and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0031588 and AMP-activated protein kinase complex and cellular component this GO :0042304 and regulation of fatty acid biosynthetic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0061024 and membrane organization and biological process, this GO :0004679: AMP-activated protein kinase activity, this GO :0004679: AMP-activated protein kinase activity and also this GO :0005515: protein binding and also this GO :0042802: identical protein binding, this GO :0005515: protein binding, this GO :0042802: identical protein binding, protein kinase
Identity 9379
Gene PRKAB2
Long gene name protein kinase AMP-activated non-catalytic subunit beta 2
Synonyms gene name AMP-activated, beta 2 non-catalytic subunit , protein kinase
Synonyms name AMPK beta 2
Locus 1q21, 1
Discovery year 1997-05-09
GenBank acession BC053610
Entrez gene record 5565
Pubmed identfication 8557660
RefSeq identity NM_005399
Havana BLAST/BLAT OTTHUMG00000014032

Similar products

Subscribe to our Newsletter