Filters

Bradykinin Antibody / Kininogen

Bradykinin Antibody / Kininogen size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenBradykinin / Kininogen
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the Bradykinin antibody should be determined by the researcher
Intented useThis Bradykinin antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O08677
PurityAntigen affinity
Description Also, HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system, In addition to that, In contrast to HMWK, It is mapped to 3q27, KNG1, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system, LMWK is not involved in blood coagulation, The KNG1 gene uses alternative splicing to generate two different proteins &ndash, a peptide causing numerous physiological effects, also known as BDK or bradykinin, high &ndash, is a protein that in humans is encoded by the KNG1 gene, is released from HMWK, molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK), 3, Kininogen-1 (KNG1)
ImmunogenAmino acids ECRGNLFMDINNKIANFSQSCTLYSGDDLVEAL of mouse Bradykinin were used as the immunogen for the Bradykinin antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Bradykinin antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetBradykinin / Kininogen
Short nameBradykinin Antibody / Kininogen
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameBradykinin (Antibody to) / Kininogen
Alternative techniqueantibodies

Similar products

Subscribe to our Newsletter