Filters

CYP27B1 Antibody

CYP27B1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenCYP27B1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the CYP27B1 antibody should be determined by the researcher
Intented useThis CYP27B1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O15528
PurityAntigen affinity
Description Mutations in this gene can result in vitamin D-dependent rickets type I, The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position, This reaction synthesizes 1alpha, Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis, steroids and other lipids, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism, 25-dihydroxyvitamin D3, CYP27B1 belongs to the cytochrome P450 superfamily of enzymes
ImmunogenAmino acids HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR of human CYP27B1 were used as the immunogen for the CYP27B1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CYP27B1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetCYP27B1
Short nameCYP27B1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name family 27, polypeptide 1 (Antibody to), subfamily B, cytochrome P450
Alternative techniqueantibodies
Alternative to gene target BT, CP2B and CYP1 and CYP1alpha and CYP27B and P450c1 and PDDR and VDD1 and VDDR and VDDRI and VDR, CYP27B1 and IDBG-43755 and ENSG00000111012 and 1594, Cyp27b1 and IDBG-194013 and ENSMUSG00000006724 and 13115, Cytoplasm, acting on paired donors, acting on paired donors, acting on paired donors, family 27, oxidoreductase activity, polypeptide 1, subfamily B, this GO :0004498 and calcidiol 1-monooxygenase activity and molecular function this GO :0005506 and iron ion binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0006766 and vitamin metabolic process and biological process this GO :0006805 and xenobiotic metabolic process and biological process this GO :0006816 and calcium ion transport and biological process this GO :0008202 and steroid metabolic process and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0010956 and negative regulation of calcidiol 1-monooxygenase activity and biological process this GO :0010980 and positive regulation of vitamin D 24-hydroxylase activity and biological process this GO :0016705 and oxidoreductase activity, this GO :0004498: calcidiol 1-monooxygenase activity, this GO :0004498: calcidiol 1-monooxygenase activity and also this GO :0005506: iron ion binding and also this GO :0016705: oxidoreductase activity, this GO :0005506: iron ion binding, this GO :0016705: oxidoreductase activity, this GO :0020037: heme binding, with incorporation or reduction of molecular oxygen, with incorporation or reduction of molecular oxygen and also this GO :0020037: heme binding, with incorporation or reduction of molecular oxygen and molecular function this GO :0020037 and heme binding and molecular function this GO :0030282 and bone mineralization and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030500 and regulation of bone mineralization and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033280 and response to vitamin D and biological process this GO :0034341 and response to interferon-gamma and biological process this GO :0036378 and calcitriol biosynthetic process from calciol and biological process this GO :0042359 and vitamin D metabolic process and biological process this GO :0042369 and vitamin D catabolic process and biological process this GO :0043627 and response to estrogen and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045618 and positive regulation of keratinocyte differentiation and biological process this GO :0046697 and decidualization and biological process this GO :0055074 and calcium ion homeostasis and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070314 and G1 to G0 transition and biological process this GO :0070564 and positive regulation of vitamin D receptor signaling pathway and biological process, 61430 and IDBG-634881 and ENSBTAG00000016906 and 539630, cytochrome P450
Identity 2606
Gene CYP27B1
Long gene name cytochrome P450 family 27 subfamily B member 1
Synonyms gene VDD1 PDDR
Synonyms gene name cytochrome P450, family 27, polypeptide 1 , polypeptide 1 cytochrome P450, subfamily B, subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase)
Synonyms CYP1 P450c1
Synonyms name VDDR I 1alpha(OH)ase 25-Hydroxyvitamin D3 1alpha-hydroxylase
Locus 12q14, 1
Discovery year 1998-03-24
GenBank acession AB006987
Entrez gene record 1594
Pubmed identfication 9295274 9344864
RefSeq identity NM_000785
Classification Cytochrome P450 family 27
Havana BLAST/BLAT OTTHUMG00000170457

Similar products

Subscribe to our Newsletter