Filters

DARPP-32 Antibody

DARPP-32 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenDARPP-32
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the DARPP-32 antibody should be determined by the researcher
Intented useThis DARPP-32 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9UD71
PurityAntigen affinity
Description As a target for dopamine, Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor, Multiple transcript variants encoding different isoforms have been found for this gene, This gene encodes a bifunctional signal transduction molecule, also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene, this gene may serve as a therapeutic target for neurologic and psychiatric disorders, Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)
ImmunogenAmino acids MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA of human DARPP-32 were used as the immunogen for the DARPP-32 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the DARPP-32 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization minor nuclear, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetDARPP-32
Short nameDARPP-32 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameDARPP-32 (Antibody to)
Alternative techniqueantibodies
Identity 9287
Gene PPP1R1B
Long gene name protein phosphatase 1 regulatory inhibitor subunit 1B
Synonyms gene name protein phosphatase 1, regulatory (inhibitor) subunit 1B
Synonyms DARPP-32 FLJ20940
Synonyms name dopamine and cAMP regulated phosphoprotein
Locus 17q12
Discovery year 1993-01-22
GenBank acession AI124650
Entrez gene record 84152
Pubmed identfication 8120638
RefSeq identity NM_032192
Classification Protein phosphatase 1 regulatory subunits
Havana BLAST/BLAT OTTHUMG00000133210

Similar products

Subscribe to our Newsletter