Filters

Eph Receptor B1 Antibody / EphB1

Eph Receptor B1 Antibody / EphB1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenEph Receptor B1 / EphB1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the EPHB1 antibody should be determined by the researcher
Intented useThis EPHB1antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P54762
PurityAntigen affinity
Description Based on their structures and sequence relationships, Ephrin receptors and their ligands, Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family, The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands, The protein encoded by this gene is a receptor for ephrin-B family members, and the ephrin-B (EFNB) class, ephrins are divided into the ephrin-A (EFNA) class, mediate numerous developmental processes, particularly in the nervous system, the ephrins, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, which are transmembrane proteins, Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene
ImmunogenAmino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the EPHB1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membrane, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetEph Receptor B1 / EphB1
Short nameEph Receptor B1 Antibody / EphB1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameEph Receptor B1 (Antibody to) / EphB1
Alternative techniqueantibodies

Similar products

Subscribe to our Newsletter