Filters

ETV4 Antibody / PEA3

ETV4 Antibody / PEA3 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenETV4 / PEA3
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the ETV4 antibody should be determined by the researcher
Intented useThis ETV4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P43268
PurityAntigen affinity
Description E1AF can activate the promoters of various matrix metalloproteinases, It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene, It is mapped to 17q21, Pea3 is detected in cells of epithelial and fibroblastic origin, also known as polyoma enhancer activator 3 (PEA3), by 10 to 20 fold, genes whose expression is associated with tumor cell invasion and metastasis, is a member of the PEA3 subfamily of Ets transcription factors, or E1AF, 31, ETS translocation variant 4 (ETV4)
ImmunogenAmino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ETV4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetETV4 / PEA3
Short nameETV4 Antibody / PEA3
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameETV4 (Antibody to) / PEA3
Alternative techniqueantibodies
Identity 3493
Gene ETV4
Long gene name ETS variant 4
Synonyms gene name E1AF) , ets variant gene 4 (E1A enhancer-binding protein
Synonyms E1A-F E1AF PEA3
Synonyms name E1A enhancer binding protein
Locus 17q21, 31
Discovery year 1995-03-27
GenBank acession U18018
Entrez gene record 2118
Pubmed identfication 8530053 1547944
RefSeq identity NM_001986
Classification ETS transcription factor family
Havana BLAST/BLAT OTTHUMG00000180884

Similar products

Subscribe to our Newsletter