Name : FMRP Antibody / FMR1
Supplier : NJS POLY
Price :406
SKU : GEN2816806387
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | FMRP / FMR1 |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | WB |
| Recommended dilutions | 1-0, 5ug/ml, Western blot: 0 |
| Notes | Optimal dilution of the FMRP antibody should be determined by the researcher |
| Intented use | This FMRP antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | Q06787 |
| Purity | Antigen affinity |
| Description | A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, Additionally, Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1), Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene, Mutations of this gene can lead to fragile X syndrome, Parkinson's disease, The protein encoded by this gene binds RNA and is associated with polysomes, This protein, autism, but an expansion to 55-230 repeats is the cause of fragile X syndrome, developmental delays and other cognitive deficits, is essential for normalcognitive developmentand female reproductive function, mental retardation, most commonly found in the brain, or FMRP, premature ovarian failure, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm, FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein |
| Immunogen | Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FMRP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | FMRP / FMR1 |
| Short name | FMRP Antibody / FMR1 |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | FMRP (Antibody to) / FMR1 |
| Alternative technique | antibodies |
| Identity | 3775 |
| Gene | FMR1 |
| Long gene name | fragile X mental retardation 1 |
| Synonyms gene | POF1 POF |
| Synonyms gene name | premature ovarian failure 1 |
| Synonyms | FMRP FRAXA MGC87458 |
| Locus | Xq27, 3 |
| Discovery year | 1992-01-17 |
| GenBank acession | X69962 |
| Entrez gene record | 2332 |
| Pubmed identfication | 1572655 |
| RefSeq identity | NM_002024 |
| Havana BLAST/BLAT | OTTHUMG00000022606 |
| Locus Specific Databases | Mental Retardation database LRG_762 |