Filters

FMRP Antibody / FMR1

FMRP Antibody / FMR1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenFMRP / FMR1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the FMRP antibody should be determined by the researcher
Intented useThis FMRP antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q06787
PurityAntigen affinity
Description A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, Additionally, Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1), Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene, Mutations of this gene can lead to fragile X syndrome, Parkinson's disease, The protein encoded by this gene binds RNA and is associated with polysomes, This protein, autism, but an expansion to 55-230 repeats is the cause of fragile X syndrome, developmental delays and other cognitive deficits, is essential for normalcognitive developmentand female reproductive function, mental retardation, most commonly found in the brain, or FMRP, premature ovarian failure, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm, FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein
ImmunogenAmino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FMRP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetFMRP / FMR1
Short nameFMRP Antibody / FMR1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameFMRP (Antibody to) / FMR1
Alternative techniqueantibodies
Identity 3775
Gene FMR1
Long gene name fragile X mental retardation 1
Synonyms gene POF1 POF
Synonyms gene name premature ovarian failure 1
Synonyms FMRP FRAXA MGC87458
Locus Xq27, 3
Discovery year 1992-01-17
GenBank acession X69962
Entrez gene record 2332
Pubmed identfication 1572655
RefSeq identity NM_002024
Havana BLAST/BLAT OTTHUMG00000022606
Locus Specific Databases Mental Retardation database LRG_762

Similar products

Subscribe to our Newsletter