Filters

FOXA3 Antibody

FOXA3 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenFOXA3
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the FOXA3 antibody should be determined by the researcher
Intented useThis FOXA3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P55318
PurityAntigen affinity
Description HNF-3G is a member of the forkhead class of DNA-binding proteins, Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver, The crystal structure of a similar protein in rat has been resolved, These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, This gene is mapped to 19q13, also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), and they also interact with chromatin, is a protein that in humans is encoded by the FOXA3 gene, 32, Hepatocyte nuclear factor 3-gamma (HNF-3G)
ImmunogenAmino acids ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF of human FOXA3 were used as the immunogen for the FOXA3 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FOXA3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetFOXA3
Short nameFOXA3 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameFOXA3 (Antibody to)
Alternative techniqueantibodies
Identity 5023
Gene FOXA3
Long gene name forkhead box A3
Synonyms gene HNF3G
Synonyms gene name gamma , hepatocyte nuclear factor 3
Locus 19q13, 32
Discovery year 1998-02-11
GenBank acession L12141
Entrez gene record 3171
Pubmed identfication 9119385
Classification Forkhead boxes
Havana BLAST/BLAT OTTHUMG00000182484

Similar products

Subscribe to our Newsletter