Filters

GRK6 Antibody

GRK6 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenGRK6
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the GRK6 antibody should be determined by the researcher
Intented useThis GRK6 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P43250
PurityAntigen affinity
Description Also, GRK6 appears to be involved in responses tomorphine, It is mapped to 5q35, Several transcript variants encoding different isoforms have been described for this gene, The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation, This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family, G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene
ImmunogenAmino acids QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR of human GRK6 were used as the immunogen for the GRK6 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GRK6 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetGRK6
Short nameGRK6 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameGRK6 (Antibody to)
Alternative techniqueantibodies
Identity 4545
Gene GRK6
Long gene name G protein-coupled receptor kinase 6
Synonyms gene GPRK6
Locus 5q35, 3
Discovery year 1994-03-29
Entrez gene record 2870
Pubmed identfication 8415712
RefSeq identity NM_002082
Havana BLAST/BLAT OTTHUMG00000163401

Similar products

Subscribe to our Newsletter