Filters

HMGB3 Antibody / HMG4

HMGB3 Antibody / HMG4 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenHMGB3 / HMG4
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the HMG4 antibody should be determined by the researcher
Intented useThis HMG4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O15347
PurityAntigen affinity
Description A mutation in this gene was associated with microphthalmia, Alternative splicing results in multiple transcript variants, The encoded protein plays an important role in maintaining stem cell populations, There are numerous pseudogenes of this gene on multiple chromosomes, This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs, also known as HMG4, and may be aberrantly expressed in tumor cells, is a protein that in humans is encoded by the HMGB3 gene, syndromic 13, High-mobility group protein B
ImmunogenAmino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HMG4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetHMGB3 / HMG4
Short nameHMGB3 Antibody / HMG4
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameHMGB3 (Antibody to) / HMG4
Alternative techniqueantibodies
Identity 5004
Gene HMGB3
Long gene name high mobility group box 3
Synonyms gene HMG4
Synonyms gene name high-mobility group (nonhistone chromosomal) protein 4 high-mobility group box 3
Synonyms HMG2A MGC90319
Synonyms name non-histone chromosomal protein
Locus Xq28
Discovery year 1997-12-12
GenBank acession AF274572
Entrez gene record 3149
Pubmed identfication 9598312
RefSeq identity NM_005342
Classification Canonical high mobility group
Havana BLAST/BLAT OTTHUMG00000024162

Similar products

Subscribe to our Newsletter