Filters

HSP70 Antibody / HSPA1A

HSP70 Antibody / HSPA1A size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenHSP70 / HSPA1A
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the HSP70 antibody should be determined by the researcher
Intented useThis HSP70 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P0DMV8
PurityAntigen affinity
Description (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, HSP70-1A, HSP72 or HSP70I, HSPA1A, No protein was associated with expression of this short HSPA1A mRNA, Shimizu et al, The HSPA1 gene is mapped on 6p21, The HSPA1A gene encodes a predicted 641-amino acid protein, This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family, Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice, improved muscular architecture, is a protein that in humans is encoded by the HSPA1A gene, possibly due to lack of a TATA box or loss of internal ribosome binding sites, strength, which is found in the more common HSPA1A transcript, 33, HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1
ImmunogenAmino acids KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR of human HSPA1A were used as the immunogen for the HSP70 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSP70 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization cytoplasmic, Nuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetHSP70 / HSPA1A
Short nameHSP70 Antibody / HSPA1A
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameHSP70 (Antibody to) / HSPA1A
Alternative techniqueantibodies
Identity 5232
Gene HSPA1A
Long gene name heat shock protein family A (Hsp70) member 1A
Synonyms gene HSPA1
Synonyms gene name heat shock 70kD protein 1A heat shock 70kDa protein 1A
Synonyms HSP70-1
Locus 6p21, 33
Discovery year 2001-06-22
GenBank acession BC002453
Entrez gene record 3303
Classification Heat shock 70kDa proteins
Havana BLAST/BLAT OTTHUMG00000031201

Similar products

Subscribe to our Newsletter