| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | HSP90 beta / HSP90AB1 |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the HSP90 beta antibody should be determined by the researcher |
| Intented use | This HSP90 beta antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P08238 |
| Purity | Antigen affinity |
| Description | Alternative splicing results in multiple transcript variants, And this gene is thought to play a role in gastric apoptosis and inflammation, It is mapped to chromosome 6p21, Pseudogenes have been identified on multiple chromosomes, This gene encodes a member of the heat shock protein 90 family, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene, protein folding and degradation and morphological evolution, these proteins are involved in signal transduction, 1, Heat shock protein HSP 90-beta |
| Immunogen | Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSP90 beta antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Cytoplasmic |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | HSP90 beta / HSP90AB1 |
| Short name | HSP90 beta Antibody / HSP90AB1 |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | class B member 1, HSP90 b (Antibody to) / heat shock protein 90kDa a (cytosolic) |
| Alternative technique | antibodies |
| Alternative to gene target | BT, Cell surfaces, D6S182 and HSP84 and HSP90B and HSPC2 and HSPCB, HSP90AB1 and IDBG-89293 and ENSG00000096384 and 3326, Hsp90ab1 and IDBG-185482 and ENSMUSG00000023944 and 15516, class B member 1, leucine rich repeat containing receptor signaling pathway and biological process this GO :0038096 and Fc-gamma receptor signaling pathway involved in pha this GO cytosis and biological process this GO :0042470 and melanosome and cellular component this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044325 and ion channel binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045793 and positive regulation of cell size and biological process this GO :0051082 and unfolded protein binding and molecular function this GO :0060334 and regulation of interferon-gamma-mediated signaling pathway and biological process this GO :0060338 and regulation of type I interferon-mediated signaling pathway and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071353 and cellular response to interleukin-4 and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071902 and positive regulation of protein serine/threonine kinase activity and biological process, this GO :0001890 and placenta development and biological process this GO :0002134 and UTP binding and molecular function this GO :0002135 and CTP binding and molecular function this GO :0003725 and double-stranded RNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0006457 and protein folding and biological process this GO :0006950 and response to stress and biological process this GO :0006986 and response to unfolded protein and biological process this GO :0007411 and axon guidance and biological process this GO :0008180 and COP9 signalosome and cellular component this GO :0009651 and response to salt stress and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016234 and inclusion body and cellular component this GO :0016323 and basolateral plasma membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0017098 and sulfonylurea receptor binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0023026 and MHC class II protein complex binding and molecular function this GO :0030235 and nitric-oxide synthase regulator activity and molecular function this GO :0030911 and TPR domain binding and molecular function this GO :0031526 and brush border membrane and cellular component this GO :0032092 and positive regulation of protein binding and biological process this GO :0032435 and negative regulation of proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0032564 and dATP binding and molecular function this GO :0033160 and positive regulation of protein import into nucleus, this GO :0002134: UTP binding, this GO :0002134: UTP binding and also this GO :0002135: CTP binding and also this GO :0003725: double-stranded RNA binding and also this GO :0005515: protein binding and also this GO :0005524: ATP binding and also this GO :0005525: GTP binding and also this GO :0017098: sulfonylurea receptor binding and also this GO :0019901: protein kinase binding and also this GO :0023026: MHC class II protein complex binding and also this GO :0030235: nitric-oxide synthase regulator activity and also this GO :0030911: TPR domain binding and also this GO :0032564: dATP binding and also this GO :0044325: ion channel binding and also this GO :0044822: poly(A) RNA binding and also this GO :0051082: unfolded protein binding, this GO :0002135: CTP binding, this GO :0003725: double-stranded RNA binding, this GO :0005515: protein binding, this GO :0005524: ATP binding, this GO :0005525: GTP binding, this GO :0017098: sulfonylurea receptor binding, this GO :0019901: protein kinase binding, this GO :0023026: MHC class II protein complex binding, this GO :0030235: nitric-oxide synthase regulator activity, this GO :0030911: TPR domain binding, this GO :0032564: dATP binding, this GO :0044325: ion channel binding, this GO :0044822: poly(A) RNA binding, this GO :0051082: unfolded protein binding, translocation and biological process this GO :0035872 and nucleotide-binding domain, unfolded protein binding, 64721 and IDBG-638535 and ENSBTAG00000047699 and 767874, heat shock protein 90kDa alpha (cytosolic) |
| Identity | 5258 |
| Gene | HSP90AB1 |
| Long gene name | heat shock protein 90 alpha family class B member 1 |
| Synonyms gene | HSPC2 HSPCB |
| Synonyms gene name | beta heat shock 90kDa protein 1, beta heat shock protein 90kDa alpha (cytosolic), class B member 1 , heat shock 90kD protein 1 |
| Locus | 6p21, 1 |
| Discovery year | 1990-06-27 |
| GenBank acession | AF275719 |
| Entrez gene record | 3326 |
| Pubmed identfication | 2768249 16269234 |
| RefSeq identity | NM_007355 |
| Classification | Heat shock 90kDa proteins |
| Havana BLAST/BLAT | OTTHUMG00000014761 |
Technique
Supplier
Species
Label
Iso Type
Host
Tissue