Filters

KCNA3 Antibody / Kv1.3

KCNA3 Antibody / Kv1.3 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigen3, KCNA3 / Kv1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the KCNA3 antibody should be determined by the researcher
Intented useThis KCNA3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P22001
PurityAntigen affinity
Description And Kv1, It belongs to the delayed rectifier class, It plays an essential role in T-cell proliferation and activation, Kv1, The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1, This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1, This gene encodes a member of the potassium channel, This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment, Thus, also known as KCNA3 or Kv1, is a protein that in humans is encoded by the KCNA3 gene, member 3, members of which allow nerve cells to efficiently repolarize following an action potential, shaker-related subfamily, shaker-related subfamily, voltage-gated, 3, 3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes, 3 modulation may be one of many mechanisms that contribute to apoptosis, 3 via a lysine residue, Potassium voltage-gated channel
ImmunogenAmino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the KCNA3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target3, KCNA3 / Kv1
Short name3, KCNA3 Antibody / Kv1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name3, KCNA3 (Antibody to) / Kv1
Alternative techniqueantibodies
Identity 6221
Gene KCNA3
Long gene name potassium voltage-gated channel subfamily A member 3
Synonyms gene name member 3 potassium channel , potassium voltage-gated channel, shaker-related subfamily
Synonyms Kv1, 3 MK3 HLK3 HPCN3
Locus 1p13, 3
Discovery year 1991-08-13
GenBank acession L23499
Entrez gene record 3738
Pubmed identfication 2251283 16382104
RefSeq identity NM_002232
Classification Potassium voltage-gated channels
Havana BLAST/BLAT OTTHUMG00000034493

Similar products

Subscribe to our Newsletter