| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | LIF Receptor / LIFR |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | WB |
| Recommended dilutions | 1-0, 5ug/ml, Western blot: 0 |
| Notes | Optimal dilution of the LIFR antibody should be determined by the researcher |
| Intented use | This LIFR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P42702 |
| Purity | Antigen affinity |
| Description | A translocation that involves the promoter of this gene, Multiple splice variants encoding the same protein have been found for this gene, Mutations in this gene cause Schwartz-Jampel syndrome type 2, This gene encodes a protein that belongs to the type I cytokine receptor family, This protein combines with a high-affinity converter subunit, a common type of benign epithelial tumor of the salivary gland, a disease belonging to the group of the bent-bone dysplasias, a polyfunctional cytokine that is involved in cellular differentiation, gp130, is a subunit of a receptor for leukemia inhibitory factor, is associated with salivary gland pleiomorphic adenoma, proliferation and survival in the adult and the embryo, t(5, to form a receptor complex that mediates the action of the leukemia inhibitory factor, 8)(p13, LIFR also known as CD118 (Cluster of Differentiation 118), q12) with the pleiomorphic adenoma gene 1 |
| Immunogen | Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the LIFR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | LIF Receptor / LIFR |
| Short name | LIF Receptor Antibody / LIFR |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | leukemia inhibitory factor Receptor (Antibody to) / leukemia inhibitory factor receptor alpha |
| Alternative technique | antibodies |
| Alternative to gene target | CD118 and LIF-R and SJS2 and STWS and SWS, CDF and DIA and HILDA and MLPLI, Extracellular, Extracellular, LIF and IDBG-3968 and ENSG00000128342 and 3976, LIF and IDBG-636335 and ENSBTAG00000007424 and 280840, LIFR and IDBG-17489 and ENSG00000113594 and 3977, LIFR and IDBG-630017 and ENSBTAG00000010423 and 539504, Lif and IDBG-142317 and ENSMUSG00000034394 and 16878, Lifr and IDBG-128297 and ENSMUSG00000054263 and 16880, growth factor activity, growth factor binding, leukemia inhibitory factor receptor alpha, this GO :0001135 and RNA polymerase II transcription factor recruiting transcription factor activity and molecular function this GO :0001974 and blood vessel remodeling and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005146 and leukemia inhibitory factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006955 and immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007566 and embryo implantation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019827 and stem cell maintenance and biological process this GO :0030324 and lung development and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033141 and positive regulation of peptidyl-serine phosphorylation of STAT protein and biological process this GO :0042503 and tyrosine phosphorylation of Stat3 protein and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045595 and regulation of cell differentiation and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045835 and negative regulation of meiosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046697 and decidualization and biological process this GO :0046888 and negative regulation of hormone secretion and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048644 and muscle organ morphogenesis and biological process this GO :0048666 and neuron development and biological process this GO :0048711 and positive regulation of astrocyte differentiation and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process this GO :0048863 and stem cell differentiation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0060135 and maternal process involved in female pregnancy and biological process this GO :0060426 and lung vasculature development and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0060707 and trophoblast giant cell differentiation and biological process this GO :0060708 and spongiotrophoblast differentiation and biological process this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0072307 and regulation of metanephric nephron tubule epithelial cell differentiation and biological process this GO :1900182 and positive regulation of protein localization to nucleus and biological process this GO :1901676 and positive regulation of histone H3-K27 acetylation and biological process, this GO :0001135: RNA polymerase II transcription factor recruiting transcription factor activity, this GO :0001135: RNA polymerase II transcription factor recruiting transcription factor activity and also this GO :0005102: receptor binding and also this GO :0005125: cytokine activity and also this GO :0005146: leukemia inhibitory factor receptor binding and also this GO :0008083: growth factor activity, this GO :0004897 and ciliary neurotrophic factor receptor activity and molecular function this GO :0004923 and leukemia inhibitory factor receptor activity and molecular function this GO :0004924 and oncostatin-M receptor activity and molecular function this GO :0005127 and ciliary neurotrophic factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019838 and growth factor binding and molecular function this GO :0034097 and response to cytokine and biological process this GO :0038165 and oncostatin-M-mediated signaling pathway and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process this GO :0070120 and ciliary neurotrophic factor-mediated signaling pathway and biological process, this GO :0004897: ciliary neurotrophic factor receptor activity, this GO :0004897: ciliary neurotrophic factor receptor activity and also this GO :0004923: leukemia inhibitory factor receptor activity and also this GO :0004924: oncostatin-M receptor activity and also this GO :0005127: ciliary neurotrophic factor receptor binding and also this GO :0005515: protein binding and also this GO :0019838: growth factor binding, this GO :0004923: leukemia inhibitory factor receptor activity, this GO :0004924: oncostatin-M receptor activity, this GO :0005102: receptor binding, this GO :0005125: cytokine activity, this GO :0005127: ciliary neurotrophic factor receptor binding, this GO :0005146: leukemia inhibitory factor receptor binding, this GO :0005515: protein binding, this GO :0008083: growth factor activity, this GO :0019838: growth factor binding, leukemia inhibitory factor |
| Identity | 6597 |
| Gene | LIFR |
| Long gene name | leukemia inhibitory factor receptor alpha |
| Synonyms gene name | leukemia inhibitory factor receptor |
| Synonyms | CD118 |
| Locus | 5p13, 1 |
| Discovery year | 1992-08-24 |
| GenBank acession | X61615 |
| Entrez gene record | 3977 |
| Pubmed identfication | 1915266 |
| RefSeq identity | NM_002310 |
| Classification | CD molecules Fibronectin type III domain containing |
| Havana BLAST/BLAT | OTTHUMG00000131138 |
Technique
Supplier
Species
Label
Iso Type
Host
Tissue