Filters

LIM Kinase 1 Antibody / LIMK1

LIM Kinase 1 Antibody / LIMK1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenLIM Kinase 1 / LIMK1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0
NotesOptimal dilution of the LIMK antibody should be determined by the researcher
Intented useThis LIMK antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P53667
PurityAntigen affinity
Description Although zinc fingers usually function by binding to DNA or RNA, LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers, LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development, There are approximately 40 known eukaryotic LIM proteins, a central PDZ domain, and a C-terminal protein kinase domain, so named for the LIM domains they contain, the LIM motif probably mediates protein-protein interactions, LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene
ImmunogenAmino acids KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR of human LIMK1 were used as the immunogen for the LIMK antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the LIMK antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetLIM Kinase 1 / LIMK1
Short nameLIM Kinase 1 Antibody / LIMK1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameLIM phosphorylation catalyst 1 (Antibody to) / LIMK1
Alternative techniqueantibodies
Identity 6613
Gene LIMK1
Long gene name LIM domain kinase 1
Synonyms LIMK
Locus 7q11, 23
Discovery year 1996-03-14
GenBank acession D26309
Entrez gene record 3984
Pubmed identfication 8673124 8812460
RefSeq identity NM_002314
Classification LIM domain containing PDZ domain containing
Havana BLAST/BLAT OTTHUMG00000023448

Similar products

Subscribe to our Newsletter