Filters

MUNC18-1 Antibody / STXBP1

MUNC18-1 Antibody / STXBP1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenMUNC18-1 / STXBP1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the MUNC18-1 antibody should be determined by the researcher
Intented useThis MUNC18-1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P61764
PurityAntigen affinity
Description Alternatively spliced transcript variants have been described, By fluorescence in situ hybridization, Mutations in this gene have been associated with infantile epileptic encephalopathy-4, The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, This gene encodes a syntaxin-binding protein, a transmembrane attachment protein receptor, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene, the STXBP1 gene is mapped to chromosome 9q34, 1, Syntaxin-binding protein 1
ImmunogenAmino acids KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD of human MUNC18-1 were used as the immunogen for the MUNC18-1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MUNC18-1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membranous, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetMUNC18-1 / STXBP1
Short nameMUNC18-1 Antibody / STXBP1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameMUNC18-1 (Antibody to) / syntaxin binding protein 1
Alternative techniqueantibodies
Alternative to gene target GABAergic and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043234 and protein complex and cellular component this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045921 and positive regulation of exocytosis and biological process this GO :0045956 and positive regulation of calcium ion-dependent exocytosis and biological process this GO :0047485 and protein N-terminus binding and molecular function this GO :0050796 and regulation of insulin secretion and biological process this GO :0050821 and protein stabilization and biological process this GO :0060292 and long term synaptic depression and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070527 and platelet aggregation and biological process, MUNC18-1 and NSEC1 and P67 and RBSEC1 and UNC18, Plasma membranes, STXBP1 and IDBG-638972 and ENSBTAG00000003525 and 282378, STXBP1 and IDBG-86143 and ENSG00000136854 and 6812, Stxbp1 and IDBG-161623 and ENSMUSG00000026797 and 20910, protein N-terminus binding, this GO :0000149 and SNARE binding and molecular function this GO :0002576 and platelet degranulation and biological process this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006112 and energy reserve metabolic process and biological process this GO :0006887 and exocytosis and biological process this GO :0006904 and vesicle docking involved in exocytosis and biological process this GO :0007268 and synaptic transmission and biological process this GO :0007269 and neurotransmitter secretion and biological process this GO :0007274 and neuromuscular synaptic transmission and biological process this GO :0007412 and axon target recognition and biological process this GO :0010807 and regulation of synaptic vesicle priming and biological process this GO :0014047 and glutamate secretion and biological process this GO :0015031 and protein transport and biological process this GO :0016188 and synaptic vesicle maturation and biological process this GO :0016192 and vesicle-mediated transport and biological process this GO :0017075 and syntaxin-1 binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0019904 and protein domain specific binding and molecular function this GO :0019905 and syntaxin binding and molecular function this GO :0031091 and platelet alpha granule and cellular component this GO :0032229 and negative regulation of synaptic transmission, this GO :0000149: SNARE binding, this GO :0000149: SNARE binding and also this GO :0005515: protein binding and also this GO :0017075: syntaxin-1 binding and also this GO :0019901: protein kinase binding and also this GO :0019904: protein domain specific binding and also this GO :0019905: syntaxin binding and also this GO :0042802: identical protein binding and also this GO :0044822: poly(A) RNA binding and also this GO :0047485: protein N-terminus binding, this GO :0005515: protein binding, this GO :0017075: syntaxin-1 binding, this GO :0019901: protein kinase binding, this GO :0019904: protein domain specific binding, this GO :0019905: syntaxin binding, this GO :0042802: identical protein binding, this GO :0044822: poly(A) RNA binding, this GO :0047485: protein N-terminus binding, syntaxin binding protein 1
Identity 11444
Gene STXBP1
Long gene name syntaxin binding protein 1
Synonyms hUNC18 MUNC18-1 UNC18 rbSec1
Synonyms name syntaxin-binding protein 1
Locus 9q34, 11
Discovery year 1996-12-27
GenBank acession AF004563
Entrez gene record 6812
Pubmed identfication 9545644
RefSeq identity NM_003165
Havana BLAST/BLAT OTTHUMG00000020713

Similar products

Subscribe to our Newsletter