Filters

NFIA Antibody

NFIA Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenNFIA
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis NFIA antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q12857
PurityAntigen affinity
Description DNA-binding specificity, Diversity in this protein family is generated by multiple genes, Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, They function as cellular transcription factors and as replication factors for adenovirus DNA replication, and heterodimerization, and possibly identical, differential splicing, Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene
ImmunogenAmino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the NFIA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetNFIA
Short nameNFIA Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameNFIA (Antibody to)
Alternative techniqueantibodies
Identity 7784
Gene NFIA
Long gene name nuclear factor I A
Synonyms gene name nuclear factor I/A
Synonyms NFI-L KIAA1439
Locus 1p31, 3
Discovery year 1995-03-09
GenBank acession U07809
Entrez gene record 4774
Pubmed identfication 7590749
RefSeq identity NM_005595
Havana BLAST/BLAT OTTHUMG00000008618

Similar products

Subscribe to our Newsletter