Filters

NKCC2 Antibody / SLC12A1

NKCC2 Antibody / SLC12A1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenNKCC2 / SLC12A1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the SLC12A1 antibody should be determined by the researcher
Intented useThis SLC12A1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q13621
PurityAntigen affinity
Description It is sensitive to such diuretics as furosemide and bumetanide, It plays a key role in concentrating urine and accounts for most of the NaCl resorption, Some Bartter-like syndromes result from defects in this gene, This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa, This gene is mapped to 15q21, This gene plays a vital role in the regulation of ionic balance and cell volume, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, member 1, the basic functional units of the kidney, 1, Solute carrier family 12 (sodium/potassium/chloride transporters)
ImmunogenAmino acids DEAQKRLRISFRPGNQECYDNFLQSGETAKTD of human SLC12A1 were used as the immunogen for the SLC12A1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SLC12A1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationMembrane
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetNKCC2 / SLC12A1
Short nameNKCC2 Antibody / SLC12A1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameNKCC2 (Antibody to) / SLC12A1
Alternative techniqueantibodies
Identity 10910
Gene SLC12A1
Long gene name solute carrier family 12 member 1
Synonyms gene name member 1 , solute carrier family 12 (sodium/potassium/chloride transporter)
Synonyms NKCC2
Locus 15q21, 1
Discovery year 1994-02-16
Entrez gene record 6557
Pubmed identfication 8640224
Classification Solute carriers
Havana BLAST/BLAT OTTHUMG00000131495

Similar products

Subscribe to our Newsletter