Filters

Parvin alpha Antibody / PARVA

Parvin alpha Antibody / PARVA size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenParvin alpha / PARVA
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the PARVA antibody should be determined by the researcher
Intented useThis PARVA antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9NVD7
PurityAntigen affinity
Description It is located on 11p15, PARVA belongs to the parvin family of actin-binding proteins, Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments, The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival, 3, Parvin alpha is a protein that in humans is encoded by the PARVA gene
ImmunogenAmino acids QKLQTVLEKINETLKLPPRSIKWNVDSVHAK of human Parvin alpha were used as the immunogen for the PARVA antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PARVA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membrane, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetParvin alpha / PARVA
Short nameParvin alpha Antibody / PARVA
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name a, Parvin a (Antibody to) / parvin
Alternative techniqueantibodies
Alternative to gene target PARVA and IDBG-32473 and ENSG00000197702 and 55742, PARVA and IDBG-632993 and ENSBTAG00000000700 and 615430, Parva and IDBG-206984 and ENSMUSG00000030770 and 57342, alpha, nuclei, protein binding, this GO :0002040 and sprouting angiogenesis and biological process this GO :0003148 and outflow tract septum morphogenesis and biological process this GO :0003779 and actin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007163 and establishment or maintenance of cell polarity and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0015629 and actin cytoskeleton and cellular component this GO :0030018 and Z disc and cellular component this GO :0030027 and lamellipodium and cellular component this GO :0031532 and actin cytoskeleton reorganization and biological process this GO :0034113 and heterotypic cell-cell adhesion and biological process this GO :0034329 and cell junction assembly and biological process this GO :0034446 and substrate adhesion-dependent cell spreading and biological process this GO :0060271 and cilium morphogenesis and biological process this GO :0070252 and actin-mediated cell contraction and biological process this GO :0071670 and smooth muscle cell chemotaxis and biological process, this GO :0003779: actin binding, this GO :0003779: actin binding and also this GO :0005515: protein binding, this GO :0005515: protein binding, parvin
Identity 14652
Gene PARVA
Long gene name parvin alpha
Synonyms gene MXRA2
Synonyms gene name matrix-remodelling associated 2
Synonyms FLJ12254 FLJ10793
Locus 11p15, 3
Discovery year 2001-04-26
GenBank acession AF237771
Entrez gene record 55742
Pubmed identfication 11171322
RefSeq identity NM_018222
Classification Parvins
Havana BLAST/BLAT OTTHUMG00000165778

Similar products

Subscribe to our Newsletter