Filters

Peroxiredoxin 4 Antibody / PRDX4

Peroxiredoxin 4 Antibody / PRDX4 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPeroxiredoxin 4 / PRDX4
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications ICC, IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5-1ug/ml, 5ug/ml, ICC: 0, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the Peroxiredoxin 4 antibody should be determined by the researcher
Intented useThis Peroxiredoxin 4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q13162
PurityAntigen affinity
Description Expression of PRDX4, Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation, Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, Jin et al, The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family, Yeast 2-hybrid, alone or with PRDX1, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins, immunoprecipitation, increased the resistance of yeast cells to oxidant-induced toxicity, p65, suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step, PRDX4 (Peroxiredoxin 4) is also known as AOE37-2
ImmunogenAmino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Peroxiredoxin 4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetPeroxiredoxin 4 / PRDX4
Short namePeroxiredoxin 4 Antibody / PRDX4
Technique antibodies against human proteins, antibodies for, Antibody
Alternative namePeroxiredoxin 4 (Antibody to) / PRDX4
Alternative techniqueantibodies
Identity 17169
Gene PRDX4
Long gene name peroxiredoxin 4
Synonyms AOE37-2
Locus Xp22, 11
Discovery year 2001-11-14
GenBank acession U25182
Entrez gene record 10549
Pubmed identfication 9388242
RefSeq identity NM_006406
Classification Peroxiredoxins
Havana BLAST/BLAT OTTHUMG00000021253
Locus Specific Databases Mental Retardation database

Similar products

Subscribe to our Newsletter