PSMA1 Antibody / Proteasome 20S alpha 1

PSMA1 Antibody / Proteasome 20S alpha 1 size: 0.1mg 406

Price 406

Size 0.1mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Category	Antibody
Concentration	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form	Antigen affinity purified
Conjugation	Unconjugated
Clone	Polyclonal antibody
Recognised antigen	PSMA1 / Proteasome 20S alpha 1
Host animal	Rabbit (Oryctolagus cuniculus)
Clonality	Polyclonal (rabbit origin)
Species reactivity	Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications	IHC-P, WB
Recommended dilutions	5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer	025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use	This PSMA1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #	P25786
Purity	Antigen affinity
Description	2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits, Alternative splicing results in multiple transcript variants encoding distinct isoforms, An essential function of a modified proteasome, Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway, The core structure is composed of 4 rings of 28 non-identical subunits, The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure, This gene encodes a member of the peptidase T1A family, is the processing of class I MHC peptides, that is a 20S core alpha subunit, the immunoproteasome, Proteasome subunit alpha type-1 is a protein that in humans is encoded by the PSMA1 gene
Immunogen	Amino acids 159-204 (MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQD) from the human protein were used as the immunogen for the PSMA1 antibody
Storage	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PSMA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization	nuclear, Cytoplasmic
Properties	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target	PSMA1 / Proteasome 20S alpha 1
Short name	PSMA1 Antibody / Proteasome 20S alpha 1
Technique	antibodies against human proteins, antibodies for, Antibody
Alternative name	proteasome subunit a classification-1 isoform 3 (Antibody to) / protein degradation aggregate 20S a 1
Alternative technique	antibodies
Alternative to gene target	HC2 and HEL-S-275 and NU and PROS30, PSMA1 and IDBG-545891 and ENSG00000256206 and 5682, alpha-subunit complex and cellular component this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process, nuclei, this GO :0004175 and endopeptidase activity and molecular function this GO :0004298 and threonine-type endopeptidase activity and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005839 and proteasome core complex and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0019773 and proteasome core complex, this GO :0004175: endopeptidase activity, this GO :0004175: endopeptidase activity and also this GO :0004298: threonine-type endopeptidase activity, this GO :0004298: threonine-type endopeptidase activity, threonine-type endopeptidase activity, proteasome subunit alpha type-1 isoform 3
Identity	9530
Gene	PSMA1
Long gene name	proteasome subunit alpha 1
Synonyms gene name	1 , alpha type, macropain) subunit, proteasome (prosome
Synonyms	HC2 NU PROS30 MGC14542 MGC14575 MGC14751 MGC1667 MGC21459 MGC22853 MGC23915
Locus	11p15, 2
Discovery year	1995-05-03
GenBank acession	X61969
Entrez gene record	5682
Pubmed identfication	1398136 2025653
RefSeq identity	NM_002786
Classification	Proteasome
Havana BLAST/BLAT	OTTHUMG00000165825

PSMA1 Antibody / Proteasome 20S alpha 1

PSMA1 Antibody / Proteasome 20S alpha 1 size: 0.1mg 406

Similar products

Subscribe to our Newsletter