Name : Recombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial, ECH1
Supplier : NOVO
Price :156
SKU : GEN7377976045
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human ECH1 is produced by our E, coli expression system and the target gene encoding Thr34-Leu328 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 34, 45 kD |
| UniProt number | Q13011 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 10% Glycerol, 100 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH 8 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | ECH1, Mitochondrial, &delta, (2, (3, 4) Dienoyl-CoA Isomerase, 5) &delta |
| Short name | ECH1, Mitochondrial, (2, (3, 4)-Dienoyl-CoA Isomerase, 5)-&delta, Recombinant &delta |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | ECH1, Mitochondrial, sapiens &delta, (2, (3, 4)-Dienoyl-CoA Isomerase, 5)-&delta, recombinant H |
| Alternative technique | rec |
| Identity | 3149 |
| Gene | ECH1 |
| Long gene name | enoyl-CoA hydratase 1 |
| Synonyms gene name | enoyl Coenzyme A hydratase 1, peroxisomal , peroxisomal enoyl-CoA hydratase 1 |
| Synonyms | HPXEL |
| Synonyms name | delta3, 4-dienoyl-coenzyme A isomerase peroxisomal enoyl-CoA hydratase 1 , 5-delta2 |
| Locus | 19q13, 2 |
| Discovery year | 1995-04-26 |
| GenBank acession | U16660 |
| Entrez gene record | 1891 |
| Pubmed identfication | 7558027 |
| Havana BLAST/BLAT | OTTHUMG00000182609 |