Recombinant Human Aminopeptidase P2, XPNPEP2 (C-6His)

Recombinant Human Aminopeptidase P2, XPNPEP2 (C-6His) size: 500 µg 1613

Price 1613

Size 500 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human Aminopeptidase P2 is produced by our Mammalian expression system and the target gene encoding His22-Ala650 is expressed with a 6His tag at the C-terminus
Molecular Weight	64 kD, 71
UniProt number	O43895
State of the product	Liquid
Shipping conditions	Dry Ice/ice packs
Formulation	150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAAHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	XPNPEP2 (C-6His), Aminopeptidase P2
Short name	XPNPEP2 (C-6His), Recombinant Aminopeptidase P2
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	XPNPEP2 (C-6His), sapiens Aminopeptidase P2, recombinant H
Alternative technique	rec
Identity	12823
Gene	XPNPEP2
Long gene name	X-prolyl aminopeptidase 2
Synonyms gene name	X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound Xaa-Pro aminopeptidase 2
Locus	Xq26, 1
Discovery year	1998-02-18
GenBank acession	U90724
Entrez gene record	7512
Pubmed identfication	9375790 9628831
RefSeq identity	NM_003399
Classification	Aminopeptidases
Havana BLAST/BLAT	OTTHUMG00000022373
Locus Specific Databases	Mental Retardation database

Recombinant Human Aminopeptidase P2, XPNPEP2 (C-6His)

Recombinant Human Aminopeptidase P2, XPNPEP2 (C-6His) size: 500 µg 1613

Similar products

Subscribe to our Newsletter