Recombinant Human CD7, Leu-9 (C-Fc)

Recombinant Human CD7, Leu-9 (C-Fc) size: 1 mg 1877

Price 1877

Size 1 mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human T-Cell Antigen CD7 is produced by our Mammalian expression system and the target gene encoding Ala26-Pro180 is expressed with a Fc tag at the C-terminus
Molecular Weight	4 kD, 43
UniProt number	P09564
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	Leu-9 (C-Fc), CD7
Short name	Leu-9 (C-Fc), Recombinant CD7
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	L-leucine-9 (C-fragment c), sapiens CD7 molecule, recombinant H
Alternative technique	rec
Alternative to gene target	CD7 and IDBG-642137 and ENSBTAG00000011359 and 510073, CD7 and IDBG-73437 and ENSG00000173762 and 924, Cd7 and IDBG-214932 and ENSMUSG00000025163 and 12516, GP40 and LEU-9 and Tp40 and TP41, Plasma membranes, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042110 and T cell activation and biological process this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, CD7 molecule
Identity	1695
Gene	CD7
Long gene name	CD7 molecule
Synonyms gene name	CD7 antigen (p41)
Synonyms	GP40 LEU-9 TP41 Tp40
Synonyms name	p41 protein T-cell antigen CD7 T-cell leukemia antigen
Locus	17q25, 3
Discovery year	1986-01-01
GenBank acession	X06180
Entrez gene record	924
Pubmed identfication	1695199 3501369
RefSeq identity	NM_006137
Classification	CD molecules V-set domain containing
Havana BLAST/BLAT	OTTHUMG00000178662

Recombinant Human CD7, Leu-9 (C-Fc)

Recombinant Human CD7, Leu-9 (C-Fc) size: 1 mg 1877

Similar products

Subscribe to our Newsletter