Recombinant Human CD83, HB15 (C-Fc)

Recombinant Human CD83, HB15 (C-Fc) size: 1 mg 2283

Price 2283

Size 1 mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human CD83 is produced by our Mammalian expression system and the target gene encoding Thr20-Ala143 is expressed with a Fc tag at the C-terminus
Molecular Weight	2 kD, 41
UniProt number	Q01151
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	HB15 (C-Fc), CD83
Short name	HB15 (C-Fc), Recombinant CD83
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	HB15 (C-fragment c), sapiens CD83 molecule, recombinant H
Alternative technique	rec
Alternative to gene target	BL11 and HB15, CD83 and IDBG-62750 and ENSG00000112149 and 9308, CD83 and IDBG-636028 and ENSBTAG00000031430 and 617034, Cd83 and IDBG-147707 and ENSMUSG00000015396 and 12522, Cell surfaces, alpha-beta T cell differentiation and biological process, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0014070 and response to organic cyclic compound and biological process this GO :0032713 and negative regulation of interleukin-4 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0032743 and positive regulation of interleukin-2 production and biological process this GO :0043372 and positive regulation of CD4-positive, this GO :0005515: protein binding, this GO :0005515: protein binding, CD83 molecule
Identity	1703
Gene	CD83
Long gene name	CD83 molecule
Synonyms gene name	CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) CD83 molecule
Synonyms	HB15 BL11
Locus	6p23
Discovery year	1999-03-26
GenBank acession	Z11697
Entrez gene record	9308
Pubmed identfication	1378080 8422464
Classification	CD molecules V-set domain containing
Havana BLAST/BLAT	OTTHUMG00000014283

Recombinant Human CD83, HB15 (C-Fc)

Recombinant Human CD83, HB15 (C-Fc) size: 1 mg 2283

Similar products

Subscribe to our Newsletter