Recombinant Human CD99, MIC2 (C-6His)

Recombinant Human CD99, MIC2 (C-6His) size: 1 mg 2283

Price 2283

Size 1 mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human CD99 is produced by our Mammalian expression system and the target gene encoding Asp23-Asp122 is expressed with a 6His tag at the C-terminus
Molecular Weight	11, 13 kD
UniProt number	P14209
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADVDHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	MIC2 (C-6His), CD99
Short name	MIC2 (C-6His), Recombinant CD99
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	MIC2 (C-6His), sapiens CD99 molecule, recombinant H
Alternative technique	rec
Alternative to gene target	CD99 and IDBG-40790 and ENSG00000002586 and 4267, CD99 and IDBG-639094 and ENSBTAG00000008114 and, HBA71 and MIC2 and MIC2X and MIC2Y and MSK5X, Plasma membranes, this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process, CD99 molecule
Identity	7082
Gene	CD99
Long gene name	CD99 molecule
Synonyms gene	MIC2
Synonyms gene name	F21 and O13 CD99 antigen , antigen identified by monoclonal antibodies 12E7
Locus	Xp22, 3 , 32 and Yp11
Discovery year	2001-06-22
GenBank acession	M16279
Entrez gene record	4267
RefSeq identity	NM_001122898
Classification	CD molecules Pseudoautosomal region 1
Havana BLAST/BLAT	OTTHUMG00000021073
Locus Specific Databases	Mental Retardation database LRG_1023

Recombinant Human CD99, MIC2 (C-6His)

Recombinant Human CD99, MIC2 (C-6His) size: 1 mg 2283

Similar products

Subscribe to our Newsletter