Name : Recombinant Human Complement Component C8 γ Chain, C8G (N-6His)
Supplier : NOVO
Price :2283
SKU : GEN1815781816
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Complement component C8 gamma is produced by our E, coli expression system and the target gene encoding Gln21-Arg202 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 22, 6 kD |
| UniProt number | P07360 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVNVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | C8G (N-6His), Chain, Complement Component C8 &gamma |
| Short name | C8G (N-6His), Chain, Recombinant Complement Component C8 &gamma |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | complement component 8, epitope, gamma polypeptide (N-6His), sapiens Complement Component C8 &gamma, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | C8C, C8G and IDBG-641426 and ENSBTAG00000010520 and 517356, C8G and IDBG-92880 and ENSG00000176919 and 733, C8g and IDBG-146088 and ENSMUSG00000015083 and 69379, Extracellular, alternative pathway and biological process this GO :0006958 and complement activation, classical pathway and biological process this GO :0019835 and cytolysis and biological process this GO :0019841 and retinol binding and molecular function this GO :0030449 and regulation of complement activation and biological process this GO :0032403 and protein complex binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, gamma polypeptide, protein complex binding, this GO :0001848 and complement binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005579 and membrane attack complex and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006957 and complement activation, this GO :0001848: complement binding, this GO :0001848: complement binding and also this GO :0019841: retinol binding and also this GO :0032403: protein complex binding, this GO :0019841: retinol binding, this GO :0032403: protein complex binding, complement component 8 |
| Identity | 1354 |
| Gene | C8G |
| Long gene name | complement C8 gamma chain |
| Synonyms gene name | complement component 8, gamma polypeptide |
| Locus | 9q34, 3 |
| Discovery year | 1988-05-11 |
| GenBank acession | X06465 |
| Entrez gene record | 733 |
| Classification | Complement system Lipocalins |
| Havana BLAST/BLAT | OTTHUMG00000020955 |