Recombinant Human Corneodesmosin, CDSN (C-6His)

Recombinant Human Corneodesmosin, CDSN (C-6His) size: 10 µg 121

Price 121

Size 10 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human Corneodesmosin is produced by our Mammalian expression system and the target gene encoding Lys33-Pro528 is expressed with a 6His tag at the C-terminus
Molecular Weight	3 kD, 49
UniProt number	Q15517
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	KSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSGSSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGSSGSHSGSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISGSSGLPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLDSPVDHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	CDSN (C-6His), Corneodesmosin
Short name	CDSN (C-6His), Recombinant Corneodesmosin
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	corneodesmosin (C-6His), sapiens Corneodesmosin, recombinant H
Alternative technique	rec
Alternative to gene target	BT, CDSN and IDBG-77127 and ENSG00000204539 and 1041, Cdsn and IDBG-178595 and ENSMUSG00000039518 and 386463, D6S586E and HTSS and HTSS1 and HYPT2 and PSS and S, multiple, this GO :0043589 and skin morphogenesis and biological process, 93339 and IDBG-634298 and ENSBTAG00000021721 and 522351, corneodesmosin
Identity	1802
Gene	CDSN
Long gene name	corneodesmosin
Synonyms	D6S586E
Locus	6p21, 33
Discovery year	1998-05-14
GenBank acession	AF030130
Entrez gene record	1041
Pubmed identfication	9395522 8415725
Havana BLAST/BLAT	OTTHUMG00000031150

Recombinant Human Corneodesmosin, CDSN (C-6His)

Recombinant Human Corneodesmosin, CDSN (C-6His) size: 10 µg 121

Similar products

Subscribe to our Newsletter