Name : Recombinant Human Cyclin-Dependent Kinase 7, CDK7 (N-6His)
Supplier : NOVO
Price :496
SKU : GEN4310075910
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Cyclin-Dependent Kinase 7 is produced by our E, coli expression system and the target gene encoding Met1-Phe346 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 2 kD, 41 |
| UniProt number | P50613 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 100 mM sodium chloride, 2 um filtered solution of 50 mM PB, 20%Glycerol pH7, 5 mM DTT, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CDK7 (N-6His), Cyclin-Dependent Kinase 7 |
| Short name | CDK7 (N-6His), Recombinant Cyclin-Dependent Kinase 7 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CDK7 (N-6His), sapiens Cyclin-Dependent phosphorylation catalyst 7, recombinant H |
| Alternative technique | rec |
| Identity | 1778 |
| Gene | CDK7 |
| Long gene name | cyclin dependent kinase 7 |
| Synonyms gene name | Xenopus laevis, cdk-activating kinase) , cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) cyclin-dependent kinase 7 (MO15 homolog |
| Synonyms | CAK1 CDKN7 MO15 STK1 CAK |
| Locus | 5q13, 2 |
| Discovery year | 1994-12-16 |
| Entrez gene record | 1022 |
| Pubmed identfication | 8069918 |
| RefSeq identity | NM_001799 |
| Classification | Cyclin dependent kinases |
| Havana BLAST/BLAT | OTTHUMG00000099358 |