Recombinant Human Cystatin F, CST7 (C-6His)

Recombinant Human Cystatin F, CST7 (C-6His) size: 50 µg 496

Price 496

Size 50 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human Cystatin F is produced by our Mammalian expression system and the target gene encoding Gly20-His145 is expressed with a 6His tag at the C-terminus
Molecular Weight	15, 58 kD
UniProt number	O76096
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCHVDHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	CST7 (C-6His), Cystatin F
Short name	CST7 (C-6His), Recombinant Cystatin F
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	CST7 (C-6His), sapiens Cystatin F, recombinant H
Alternative technique	rec
Identity	2479
Gene	CST7
Long gene name	cystatin F
Synonyms gene name	cystatin F (leukocystatin)
Synonyms name	leukocystatin
Locus	20p11, 21
Discovery year	1998-10-14
GenBank acession	AF036342
Entrez gene record	8530
Pubmed identfication	9733783 9632704
RefSeq identity	NM_003650
Classification	Cystatins, type 2
Havana BLAST/BLAT	OTTHUMG00000032108

Recombinant Human Cystatin F, CST7 (C-6His)

Recombinant Human Cystatin F, CST7 (C-6His) size: 50 µg 496

Similar products

Subscribe to our Newsletter