Name : Recombinant Human Cytochrome C, CYCS (C-6His)
Supplier : NOVO
Price :202
SKU : GEN1600949596
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Cytochrome C is produced by our E, coli expression system and the target gene encoding Gly2-Glu105 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 12, 8 kD |
| UniProt number | P99999 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 0, 20% Glycerol, pH 8, 15M sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNELEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CYCS (C-6His), Cytochrome C |
| Short name | CYCS (C-6His), Recombinant Cytochrome C |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | cytochrome c, sapiens Cytochrome C, somatic (C-6His), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CYCS and IDBG-10008 and ENSG00000172115 and 54205, electron transporter, nuclei, somatic, this GO :0000159 and protein phosphatase type 2A complex and cellular component this GO :0004722 and protein serine/threonine phosphatase activity and molecular function this GO :0005506 and iron ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005758 and mitochondrial intermembrane space and cellular component this GO :0005829 and cytosol and cellular component this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006915 and apoptotic process and biological process this GO :0008635 and activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c and biological process this GO :0009055 and electron carrier activity and molecular function this GO :0016311 and dephosphorylation and biological process this GO :0020037 and heme binding and molecular function this GO :0022904 and respiratory electron transport chain and biological process this GO :0044237 and cellular metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045155 and electron transporter, this GO :0004722: protein serine/threonine phosphatase activity, this GO :0004722: protein serine/threonine phosphatase activity and also this GO :0005506: iron ion binding and also this GO :0005515: protein binding and also this GO :0009055: electron carrier activity and also this GO :0020037: heme binding and also this GO :0045155: electron transporter, this GO :0005506: iron ion binding, this GO :0005515: protein binding, this GO :0009055: electron carrier activity, this GO :0020037: heme binding, this GO :0045155: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity and molecular function this GO :0045333 and cellular respiration and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070469 and respiratory chain and cellular component this GO :0097193 and intrinsic apoptotic signaling pathway and biological process, cytochrome c |
| Identity | 19986 |
| Gene | CYCS |
| Long gene name | cytochrome c, somatic |
| Synonyms | HCS CYC |
| Locus | 7p15, 3 |
| Discovery year | 2002-12-16 |
| GenBank acession | M22877 |
| Entrez gene record | 54205 |
| Pubmed identfication | 11790791 |
| Havana BLAST/BLAT | OTTHUMG00000128495 |
| Locus Specific Databases | LRG_876 |