Name : Recombinant Human DNA Fragmentation Factor Subunit α, DFFA, DFF45, ICAD (N-6His)
Supplier : NOVO
Price :1613
SKU : GEN4090427128
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human DFF45 is produced by our E, coli expression system and the target gene encoding Met1-Thr331 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 38, 7 kD |
| UniProt number | O00273 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | DFF45, DFFA, ICAD (N-6His), DNA Fragmentation Factor Subunit &alpha |
| Short name | DFF45, DFFA, ICAD (N-6His), Recombinant DNA Fragmentation Factor Subunit &alpha |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | 45kDa, DFF45, Desoxyribonucleic acid fragmentation factor, ICAD (N-6His), alpha polypeptide, sapiens Desoxyribonucleic acid Fragmentation Factor functionnal sequence &alpha, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | 45kDa, DFF-45 and DFF1 and ICAD, DFFA and IDBG-89047 and ENSG00000160049 and 1676, Dffa and IDBG-204894 and ENSMUSG00000028974 and 13347, alpha polypeptide, nuclei, protein binding, this GO :0000790 and nuclear chromatin and cellular component this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0007165 and signal transduction and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0070242 and thymocyte apoptotic process and biological process this GO :1900118 and negative regulation of execution phase of apoptosis and biological process this GO :1902511 and negative regulation of apoptotic DNA fragmentation and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding, DNA fragmentation factor |
| Identity | 2772 |
| Gene | DFFA |
| Long gene name | DNA fragmentation factor subunit alpha |
| Synonyms gene name | 45 kD, 45kDa, DNA fragmentation factor, alpha polypeptide , alpha polypeptide DNA fragmentation factor |
| Synonyms | DFF-45 DFF45 ICAD DFF1 |
| Synonyms name | 45 kD, DNA fragmentation factor, alpha subunit |
| Locus | 1p36, 22 |
| Discovery year | 1997-10-27 |
| GenBank acession | AF087573 |
| Entrez gene record | 1676 |
| Pubmed identfication | 9605855 9108473 |
| RefSeq identity | NM_004401 |
| Havana BLAST/BLAT | OTTHUMG00000001909 |