Name : Recombinant Human E3 Ubiquitin-Protein Ligase ZNRF1 (N, C-6His)
Supplier : NOVO
Price :496
SKU : GEN9699643834
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | 6His tag at the C-terminus, Recombinant Human Zinc ring finger protein 1 is produced by our E, coli expression system and the target gene encoding Pro74-Thr178 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 14, 4 kD |
| UniProt number | Q8ND25 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 0, pH 8, 0 , 1 mMEDTA, 10%glycerol, 15M sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | C-6His), E3 Ubiquitin-Protein Ligase ZNRF1 (N |
| Short name | C-6His), Recombinant E3 Ubiquitin-Protein Ligase ZNRF1 (N |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | C-6His), sapiens E3 Ubiquitin-Protein Ligase ZNRF1 (N, recombinant H |
| Alternative technique | rec |
| Identity | 18452 |
| Gene | ZNRF1 |
| Long gene name | zinc and ring finger 1 |
| Synonyms gene name | E3 ubiquitin protein ligase , zinc and ring finger 1 |
| Synonyms | nin283 FLJ14846 DKFZp434E229 |
| Locus | 16q23, 1 |
| Discovery year | 2004-07-02 |
| GenBank acession | AF378524 |
| Entrez gene record | 84937 |
| Classification | Ring finger proteins |
| Havana BLAST/BLAT | OTTHUMG00000137606 |