Name : Recombinant Human EIF1A, X-Chromosomal, EIF1AX (N-6His)
Supplier : NOVO
Price :2283
SKU : GEN7130042083
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human EIF1AX is produced by our E, coli expression system and the target gene encoding Met1-Ile144 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 18, 6 kD |
| UniProt number | P47813 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | EIF1AX (N-6His), X-Chromosomal, EIF1A |
| Short name | EIF1AX (N-6His), X-Chromosomal, Recombinant EIF1A |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | EIF1AX (N-6His), X-Chromosomal, sapiens EIF1A, recombinant H |
| Alternative technique | rec |
| Identity | 3250 |
| Gene | EIF1AX |
| Long gene name | X-linked , eukaryotic translation initiation factor 1A |
| Synonyms gene | EIF4C EIF1A |
| Synonyms gene name | X chromosome , eukaryotic translation initiation factor 1A |
| Synonyms | eIF-1A eIF-4C |
| Locus | Xp22, 12 |
| Discovery year | 1991-03-04 |
| GenBank acession | L18960 |
| Entrez gene record | 1964 |
| Pubmed identfication | 8106356 9381176 |
| Havana BLAST/BLAT | OTTHUMG00000022704 |