Recombinant Human Ephrin-A1, EFNA1, LERK-1 (C-6His)

Recombinant Human Ephrin-A1, EFNA1, LERK-1 (C-6His) size: 10 µg 156

Price 156

Size 10 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human Ephrin-A1 is produced by our Mammalian expression system and the target gene encoding Asp19-Ser182 is expressed with a 6His tag at the C-terminus
Molecular Weight	20, 39 kD
UniProt number	P20827
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDPEVRVLHSIAHSVDHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	EFNA1, LERK-1 (C-6His), Ephrin-A1
Short name	EFNA1, LERK-1 (C-6His), Recombinant Ephrin-A1
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	EFNA1, LERK-1 (C-6His), sapiens Ephrin-A1, recombinant H
Alternative technique	rec
Identity	3221
Gene	EFNA1
Long gene name	ephrin A1
Synonyms gene	TNFAIP4 EPLG1
Synonyms gene name	ephrin-A1
Synonyms	LERK1 ECKLG
Locus	1q22
Discovery year	1992-10-20
Entrez gene record	1942
Pubmed identfication	2233719 8660976
RefSeq identity	NM_004428
Classification	Ephrins
Havana BLAST/BLAT	OTTHUMG00000035312

Recombinant Human Ephrin-A1, EFNA1, LERK-1 (C-6His)

Recombinant Human Ephrin-A1, EFNA1, LERK-1 (C-6His) size: 10 µg 156

Similar products

Subscribe to our Newsletter