Recombinant Human Follicle-Stimulating Hormone α, β Dimer

Recombinant Human Follicle-Stimulating Hormone α, β Dimer size: 50 µg 496

Price 496

Size 50 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	FSH comprise the , Human recombinant LHRG and GHRH are produced in E, The glands that secrete Luteinizing hormones LHRG and LH, The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine , coli or in yeast cells, Hormone releasing factors and releasing hormones are , endocrine signaling system, glands , in , intracrine signaling) or nearby cells (paracrine signaling), multicellular organisms, or , produced by , signaling molecules
Molecular Weight	10, 12, 2&, 5 kD
UniProt number	P01215&, P01225
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&, NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	&beta, Dimer, Follicle-Stimulating Hormone &alpha
Short name	&beta, Dimer, Recombinant Follicle-Stimulating Hormone &alpha
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans
Alternative name	&beta, Dimer, sapiens Follicle-Stimulating Hormone &alpha, recombinant H
Alternative technique	rec

Recombinant Human Follicle-Stimulating Hormone α, β Dimer

Recombinant Human Follicle-Stimulating Hormone α, β Dimer size: 50 µg 496

Similar products

Subscribe to our Newsletter