| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human SF20 is produced by our E, coli expression system and the target gene encoding Ser33-Leu173 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 18 kD |
| UniProt number | Q969H8 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | IL25, MYDGF (N-6His), Interleukin-25 |
| Short name | IL25, MYDGF (N-6His), Recombinant Interleukin-25 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | MYDGF (N-6His), interleukin 25, sapiens Interleukin-25, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, IL25 and IDBG-3218 and ENSG00000166090 and 64806, IL25 and IDBG-645820 and ENSBTAG00000009701 and 526816, Il25 and IDBG-162540 and ENSMUSG00000040770 and 140806, interleukin-17E receptor binding, this GO :0002437 and inflammatory response to antigenic stimulus and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006954 and inflammatory response and biological process this GO :0008150 and biological process and biological process this GO :0009620 and response to fungus and biological process this GO :0009624 and response to nematode and biological process this GO :0030222 and eosinophil differentiation and biological process this GO :0030380 and interleukin-17E receptor binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process, this GO :0005125: cytokine activity, this GO :0005125: cytokine activity and also this GO :0030380: interleukin-17E receptor binding, this GO :0030380: interleukin-17E receptor binding, interleukin 25 |
| Identity | 16948 |
| Gene | MYDGF |
| Long gene name | myeloid derived growth factor |
| Synonyms gene | IL27 IL27w C19orf10 |
| Synonyms gene name | interleukin 27 working designation chromosome 19 open reading frame 10 |
| Synonyms | R33729_1 IL25 SF20 IL-25 IL-27 |
| Locus | 19p13, 3 |
| Discovery year | 2002-04-03 |
| GenBank acession | AF282264 |
| Entrez gene record | 56005 |
| Pubmed identfication | 17362502 21128247 25581518 |
| RefSeq identity | NM_019107 |