Recombinant Human β-Lactamase-Like Protein 2, LACTB2 (N-GST)

Recombinant Human β-Lactamase-Like Protein 2, LACTB2 (N-GST) size: 500 µg 1613

Price 1613

Size 500 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human LACTB2 is produced by our E, coli expression system and the target gene encoding Met1-Leu288 is expressed with a GST tag at the N-terminus
Molecular Weight	24 kD, 59
UniProt number	Q53H82
State of the product	Liquid
Shipping conditions	Dry ice/ice packs
Formulation	1 mM EDTA, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	LACTB2 (N-GST), &beta, -Lactamase-Like Protein 2
Short name	LACTB2 (N-GST), -Lactamase-Like Protein 2, Recombinant &beta
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans
Alternative name	LACTB2 (N-GST), sapiens &beta, -Lactamase-Like Protein 2, recombinant H
Alternative technique	rec
Identity	18512
Gene	LACTB2
Long gene name	lactamase beta 2
Synonyms	CGI-83
Locus	8q13, 3
Discovery year	2004-02-09
GenBank acession	AF151841
Entrez gene record	51110
RefSeq identity	NM_016027
Havana BLAST/BLAT	OTTHUMG00000164430

Recombinant Human β-Lactamase-Like Protein 2, LACTB2 (N-GST)

Recombinant Human β-Lactamase-Like Protein 2, LACTB2 (N-GST) size: 500 µg 1613

Similar products

Subscribe to our Newsletter