Name : Recombinant Human Leukemia Inhibitory Factor, LIF
Supplier : NOVO
Price :369
SKU : GEN3755614188
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Leukemia Inhibitory Factor is produced by our E, coli expression system and the target gene encoding Ser23-Phe202 is expressed |
| Molecular Weight | 19, 7 kD |
| UniProt number | P15018 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 0, 150 mM sodium chloride, pH 7, 02% Tween 20, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | LIF, Leukemia Inhibitory Factor |
| Short name | LIF, Recombinant Leukemia Inhibitory Factor |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | leukemia inhibitory factor, sapiens Leukemia Inhibitory Factor, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CDF and DIA and HILDA and MLPLI, Extracellular, LIF and IDBG-3968 and ENSG00000128342 and 3976, LIF and IDBG-636335 and ENSBTAG00000007424 and 280840, Lif and IDBG-142317 and ENSMUSG00000034394 and 16878, growth factor activity, this GO :0001135 and RNA polymerase II transcription factor recruiting transcription factor activity and molecular function this GO :0001974 and blood vessel remodeling and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005146 and leukemia inhibitory factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006955 and immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007566 and embryo implantation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019827 and stem cell maintenance and biological process this GO :0030324 and lung development and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033141 and positive regulation of peptidyl-serine phosphorylation of STAT protein and biological process this GO :0042503 and tyrosine phosphorylation of Stat3 protein and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045595 and regulation of cell differentiation and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045835 and negative regulation of meiosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046697 and decidualization and biological process this GO :0046888 and negative regulation of hormone secretion and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048644 and muscle organ morphogenesis and biological process this GO :0048666 and neuron development and biological process this GO :0048711 and positive regulation of astrocyte differentiation and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process this GO :0048863 and stem cell differentiation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0060135 and maternal process involved in female pregnancy and biological process this GO :0060426 and lung vasculature development and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0060707 and trophoblast giant cell differentiation and biological process this GO :0060708 and spongiotrophoblast differentiation and biological process this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0072307 and regulation of metanephric nephron tubule epithelial cell differentiation and biological process this GO :1900182 and positive regulation of protein localization to nucleus and biological process this GO :1901676 and positive regulation of histone H3-K27 acetylation and biological process, this GO :0001135: RNA polymerase II transcription factor recruiting transcription factor activity, this GO :0001135: RNA polymerase II transcription factor recruiting transcription factor activity and also this GO :0005102: receptor binding and also this GO :0005125: cytokine activity and also this GO :0005146: leukemia inhibitory factor receptor binding and also this GO :0008083: growth factor activity, this GO :0005102: receptor binding, this GO :0005125: cytokine activity, this GO :0005146: leukemia inhibitory factor receptor binding, this GO :0008083: growth factor activity, leukemia inhibitory factor |
| Identity | 6596 |
| Gene | LIF |
| Long gene name | leukemia inhibitory factor |
| Synonyms | CDF DIA HILDA |
| Synonyms name | differentiation inhibitory activity differentiation-inducing factor hepatocyte-stimulating factor III cholinergic differentiation factor human interleukin in DA cells |
| Locus | 22q12, 2 |
| Discovery year | 1989-06-11 |
| Entrez gene record | 3976 |
| Pubmed identfication | 1714745 8058719 |
| RefSeq identity | NM_002309 |
| Classification | Endogenous ligands Interleukin 6 cytokine family |
| Havana BLAST/BLAT | OTTHUMG00000150910 |
| Locus Specific Databases | ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database |