Name : Recombinant Human LILRA5, CD85f (C-6His)
Supplier : NOVO
Price :126
SKU : GEN2890491642
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Leukocyte Immunoglobulin-like Receptor Subfamily A Member 5 is produced by our Mammalian expression system and the target gene encoding Gly42-Arg268 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 26 |
| UniProt number | A6NI73 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD85f (C-6His), LILRA5 |
| Short name | CD85f (C-6His), Recombinant LILRA5 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD85f (C-6His), member 5, sapiens leukocyte immunoglobulin-like receptor, subfamily A (including TM domain), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | LILRA5 and IDBG-68498 and ENSG00000187116 and 353514, Plasma membranes, member 5, protein binding, subfamily A (with TM domain), this GO :0005515 and protein binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding, leukocyte immunoglobulin-like receptor |
| Identity | 16309 |
| Gene | LILRA5 |
| Long gene name | leukocyte immunoglobulin like receptor A5 |
| Synonyms gene | LILRB7 |
| Synonyms gene name | leukocyte immunoglobulin-like receptor, member 5 , subfamily A (with TM domain) |
| Synonyms | ILT11 LIR9 CD85 CD85f |
| Synonyms name | leucocyte Ig-like receptor A5 |
| Locus | 19q13, 42 |
| Discovery year | 2005-04-14 |
| GenBank acession | AF212842 |
| Entrez gene record | 353514 |
| Pubmed identfication | 10941842 |
| RefSeq identity | NM_181985 |
| Classification | Activating leukocyte immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000065357 |