Recombinant Human Lumican, LUM (C-6His)

Recombinant Human Lumican, LUM (C-6His) size: 1 mg 2283

Price 2283

Size 1 mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human Lumican is produced by our Mammalian expression system and the target gene encoding Gln19-Asn338 is expressed with a 6His tag at the C-terminus
Molecular Weight	37, 7 kD
UniProt number	P51884
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	1 mM EDTA, 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNVDHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	LUM (C-6His), Lumican
Short name	LUM (C-6His), Recombinant Lumican
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	LUM (C-6His), sapiens Lumican, recombinant H
Alternative technique	rec
Identity	6724
Gene	LUM
Long gene name	lumican
Synonyms gene	LDC
Synonyms	SLRR2D
Synonyms name	lumican proteoglycan
Locus	12q21, 33
Discovery year	1994-12-19
GenBank acession	BT006707
Entrez gene record	4060
Pubmed identfication	7558030
RefSeq identity	NM_002345
Classification	Small leucine rich repeat proteoglycans
Havana BLAST/BLAT	OTTHUMG00000170074

Recombinant Human Lumican, LUM (C-6His)

Recombinant Human Lumican, LUM (C-6His) size: 1 mg 2283

Similar products

Subscribe to our Newsletter