Name : Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 α, MAP1LC3A (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN5516116066
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human MAP1LC3A is produced by our E, coli expression system and the target gene encoding Met1-Phe121 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 15, 3 kD |
| UniProt number | Q9H492 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 0, 20% Glycerol, pH 8, 1M sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | MAP1LC3A (C-6His), Microtubule-Associated Protein 1 Light Chain 3 &alpha |
| Short name | MAP1LC3A (C-6His), Recombinant Microtubule-Associated Protein 1 Light Chain 3 &alpha |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | MAP1LC3A (C-6His), sapiens Microtubule-Associated Protein 1 Light epitope 3 &alpha, recombinant H |
| Alternative technique | rec |
| Identity | 6838 |
| Gene | MAP1LC3A |
| Long gene name | microtubule associated protein 1 light chain 3 alpha |
| Synonyms | MAP1BLC3 MAP1ALC3 LC3 LC3A ATG8E |
| Locus | 20q11, 22 |
| Discovery year | 2000-06-29 |
| Entrez gene record | 84557 |
| Pubmed identfication | 8833088 17580304 |
| RefSeq identity | NM_181509 |
| Classification | Autophagy related |
| Havana BLAST/BLAT | OTTHUMG00000032306 |