Recombinant Human N-Acetylglucosamine-6-Sulfatase, GNS (C-6His)

Recombinant Human N-Acetylglucosamine-6-Sulfatase, GNS (C-6His) size: 10 µg 202

Price 202

Size 10 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human N-Acetylglucosamine-6-Sulfatase is produced by our Mammalian expression system and the target gene encoding Val37-Leu552 is expressed with a 6His tag at the C-terminus
Molecular Weight	35 kD, 59
UniProt number	P15586
State of the product	Liquid
Shipping conditions	Dry Ice/ice packs
Formulation	150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	VFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLLVDHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	GNS (C-6His), N-Acetylglucosamine-6-Sulfatase
Short name	GNS (C-6His), Recombinant N-Acetylglucosamine-6-Sulfatase
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	GNS (C-6His), sapiens N-Acetylglucosamine-6-Sulfatase, recombinant H
Alternative technique	rec
Identity	4422
Gene	GNS
Long gene name	glucosamine (N-acetyl)-6-sulfatase
Synonyms name	Sanfilippo disease IIID N-acetylglucosamine-6-sulfatase
Locus	12q14, 3
Discovery year	1988-06-09
Entrez gene record	2799
Classification	Sulfatases
Havana BLAST/BLAT	OTTHUMG00000168819

Recombinant Human N-Acetylglucosamine-6-Sulfatase, GNS (C-6His)

Recombinant Human N-Acetylglucosamine-6-Sulfatase, GNS (C-6His) size: 10 µg 202

Similar products

Subscribe to our Newsletter