Name : Recombinant Human PDCD5, TFAR19 (N-6His)
Supplier : NOVO
Price :1613
SKU : GEN6967700053
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Programmed Cell Death Protein 5 is produced by our E, coli expression system and the target gene encoding Met1-Tyr125 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 16, 4 kD |
| UniProt number | O14737 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | TFAR19 (N-6His), PDCD5 |
| Short name | TFAR19 (N-6His), Recombinant PDCD5 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | TFAR19 (N-6His), sapiens programmed cellular death 5, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | DNA binding, PDCD5 and IDBG-42196 and ENSG00000105185 and 9141, PDCD5 and IDBG-635019 and ENSBTAG00000009304 and 509123, Pdcd5 and IDBG-175016 and ENSMUSG00000030417 and 100042424, TFAR19, nuclei, this GO :0003677 and DNA binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006915 and apoptotic process and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003677: DNA binding, this GO :0003677: DNA binding, 56330, programmed cell death 5 |
| Identity | 8764 |
| Gene | PDCD5 |
| Long gene name | programmed cell death 5 |
| Synonyms | TFAR19 MGC9294 |
| Synonyms name | TFAR19 novel apoptosis-related TF1 cell apoptosis-related gene 19 |
| Locus | 19q13, 11 |
| Discovery year | 1999-12-10 |
| GenBank acession | AF014955 |
| Entrez gene record | 9141 |
| Pubmed identfication | 9920759 |
| RefSeq identity | NM_004708 |
| Havana BLAST/BLAT | OTTHUMG00000180224 |