Name : Recombinant Human Peroxiredoxin-1, PRDX1 (N, C-6His)
Supplier : NOVO
Price :100
SKU : GEN7750586185
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | 6His tag at the C-terminus, Recombinant Human Peroxiredoxin-1 is produced by our E, coli expression system and the target gene encoding Met1-Lys199 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 25, 3 kD |
| UniProt number | Q06830 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 0, 10% glycerol, 1 mM DTT, 2 um filtered solution of phosphate buffered saline, Supplied as a 0, pH 6 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQKLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | C-6His), PRDX1 (N, Peroxiredoxin-1 |
| Short name | C-6His), PRDX1 (N, Recombinant Peroxiredoxin-1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | C-6His), peroxiredoxin 1 (N, sapiens Peroxiredoxin-1, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | MSP23 and NKEF-A and NKEFA and PAG and PAGA and PAGB and PRX1 and PRXI and TDPX2, PRDX1 and IDBG-640075 and ENSBTAG00000003642 and 281997, PRDX1 and IDBG-97953 and ENSG00000117450 and 5052, Prdx1 and IDBG-178542 and ENSMUSG00000028691 and 18477, nuclei, peroxiredoxin activity, this GO :0000302 and response to reactive oxygen species and biological process this GO :0001501 and skeletal system development and biological process this GO :0001895 and retina homeostasis and biological process this GO :0004601 and peroxidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005719 and nuclear euchromatin and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0005782 and peroxisomal matrix and cellular component this GO :0005829 and cytosol and cellular component this GO :0006979 and response to oxidative stress and biological process this GO :0008283 and cell proliferation and biological process this GO :0008379 and thioredoxin peroxidase activity and molecular function this GO :0016209 and antioxidant activity and molecular function this GO :0016491 and oxidoreductase activity and molecular function this GO :0019430 and removal of superoxide radicals and biological process this GO :0020037 and heme binding and molecular function this GO :0032872 and regulation of stress-activated MAPK cascade and biological process this GO :0034101 and erythrocyte homeostasis and biological process this GO :0042267 and natural killer cell mediated cytotoxicity and biological process this GO :0042345 and regulation of NF-kappaB import into nucleus and biological process this GO :0042470 and melanosome and cellular component this GO :0042744 and hydrogen peroxide catabolic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0051920 and peroxiredoxin activity and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004601: peroxidase activity, this GO :0004601: peroxidase activity and also this GO :0005515: protein binding and also this GO :0008379: thioredoxin peroxidase activity and also this GO :0016209: antioxidant activity and also this GO :0016491: oxidoreductase activity and also this GO :0020037: heme binding and also this GO :0042802: identical protein binding and also this GO :0042803: protein homodimerization activity and also this GO :0044822: poly(A) RNA binding and also this GO :0051920: peroxiredoxin activity, this GO :0005515: protein binding, this GO :0008379: thioredoxin peroxidase activity, this GO :0016209: antioxidant activity, this GO :0016491: oxidoreductase activity, this GO :0020037: heme binding, this GO :0042802: identical protein binding, this GO :0042803: protein homodimerization activity, this GO :0044822: poly(A) RNA binding, this GO :0051920: peroxiredoxin activity, peroxiredoxin 1 |
| Identity | 9352 |
| Gene | PRDX1 |
| Long gene name | peroxiredoxin 1 |
| Synonyms gene | PAGA |
| Synonyms | NKEFA |
| Locus | 1p34, 1 |
| Discovery year | 1993-11-01 |
| GenBank acession | BC021683 |
| Entrez gene record | 5052 |
| Pubmed identfication | 8496166 |
| RefSeq identity | NM_181697 |
| Classification | Peroxiredoxins |
| Havana BLAST/BLAT | OTTHUMG00000007738 |