Name : Recombinant Human Phosphatidylinositol Transfer Protein α Isoform, PITPNA (N-6His)
Supplier : NOVO
Price :1613
SKU : GEN1818518539
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human PITPNA is produced by our E, coli expression system and the target gene encoding Met1-Asp270 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 34 kD |
| UniProt number | Q00169 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 1 mM DTT, 1 mM EDTA, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | Isoform, PITPNA (N-6His), Phosphatidylinositol Transfer Protein &alpha |
| Short name | Isoform, PITPNA (N-6His), Recombinant Phosphatidylinositol Transfer Protein &alpha |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | Isoform, PITPNA (N-6His), sapiens Phosphatidylinositol Transfer Protein &alpha, recombinant H |
| Alternative technique | rec |
| Identity | 9001 |
| Gene | PITPNA |
| Long gene name | phosphatidylinositol transfer protein alpha |
| Synonyms gene | PITPN |
| Synonyms gene name | phosphotidylinositol transfer protein |
| Synonyms | VIB1A |
| Locus | 17p13, 3 |
| Discovery year | 1994-03-24 |
| GenBank acession | M73704 |
| Entrez gene record | 5306 |
| Pubmed identfication | 8255295 |
| Classification | Phosphatidylinositol transfer proteins |
| Havana BLAST/BLAT | OTTHUMG00000177779 |