Name : Recombinant Human S100 Calcium Binding Protein A6, S100A6 (N-6His)
Supplier : NOVO
Price :100
SKU : GEN1917232002
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human S100 calcium binding protein A is produced by our E, coli expression system and the target gene encoding Met1-Gly90 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 12, 5 kD |
| UniProt number | P06703 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0, pH7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | S100A6 (N-6His), S100 Calcium Binding Protein A6 |
| Short name | S100A6 (N-6His), Recombinant S100 Calcium Binding Protein A6 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | S100A6 (N-6His), sapiens S100 Calcium Binding Protein A6, recombinant H |
| Alternative technique | rec |
| Identity | 10496 |
| Gene | S100A6 |
| Long gene name | S100 calcium binding protein A6 |
| Synonyms gene | CACY |
| Synonyms gene name | S100 calcium-binding protein A6 (calcyclin) S100 calcium binding protein A6 (calcyclin) |
| Synonyms | 2A9 PRA CABP |
| Locus | 1q21, 3 |
| Discovery year | 1986-01-01 |
| GenBank acession | BC001431 |
| Entrez gene record | 6277 |
| RefSeq identity | NM_014624 |
| Classification | S100 calcium binding proteins EF-hand domain containing |
| Havana BLAST/BLAT | OTTHUMG00000013549 |