Recombinant Human Stathmin, STMN1 (C-6His)

Recombinant Human Stathmin, STMN1 (C-6His) size: 50 µg 369

Price 369

Size 50 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human Stathmin is produced by our E, coli expression system and the target gene encoding Ala2-Asp149 is expressed with a 6His tag at the C-terminus
Molecular Weight	18, 37 kD
UniProt number	P16949
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEADLEHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	STMN1 (C-6His), Stathmin
Short name	STMN1 (C-6His), Recombinant Stathmin
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	STMN1 (C-6His), sapiens Stathmin, recombinant H
Alternative technique	rec
Identity	6510
Gene	STMN1
Long gene name	stathmin 1
Synonyms gene	LAP18 C1orf215
Synonyms gene name	chromosome 1 open reading frame 215 stathmin 1/oncoprotein 18
Synonyms	SMN OP18 PR22 PP19 PP17 Lag FLJ32206
Synonyms name	oncoprotein 18
Locus	1p36, 11
Discovery year	1990-12-17
GenBank acession	J04991
Entrez gene record	3925
Pubmed identfication	2917975
RefSeq identity	NM_005563
Classification	Stathmins
Havana BLAST/BLAT	OTTHUMG00000007389

Recombinant Human Stathmin, STMN1 (C-6His)

Recombinant Human Stathmin, STMN1 (C-6His) size: 50 µg 369

Similar products

Subscribe to our Newsletter