Name : Recombinant Human Stem Cell Factor, SCF, c-Kit Ligand (C-6His)
Supplier : NOVO
Price :146
SKU : GEN5952750773
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling |
| Molecular Weight | 22 kD |
| UniProt number | P21583 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | SCF, c-Kit Ligand (C-6His), Stem Factor |
| Short name | SCF, c-Kit Ligand (C-6His), Recombinant Stem Cell Factor |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | SCF, c-reagent Ligand (C-6His), sapiens progenitor cellular Factor, recombinant H |
| Alternative technique | rec |
| Identity | 6343 |
| Gene | KITLG |
| Long gene name | KIT ligand |
| Synonyms gene | MGF |
| Synonyms | SCF SF Kitl KL-1 FPH2 |
| Synonyms name | mast cell growth factor stem cell factor steel factor familial progressive hyperpigmentation 2 |
| Locus | 12q21, 32 |
| Discovery year | 1991-06-04 |
| GenBank acession | M59964 |
| Entrez gene record | 4254 |
| Pubmed identfication | 2208279 1707188 19375057 |
| RefSeq identity | NM_003994 |
| Havana BLAST/BLAT | OTTHUMG00000169888 |